SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M5P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M5P1
Domain Number 1 Region: 8-195,296-383
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.68e-82
Family Bacterial dinuclear zinc exopeptidases 0.0000232
Further Details:      
 
Domain Number 2 Region: 181-294
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 7.72e-28
Family Bacterial exopeptidase dimerisation domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M5P1
Sequence length 392
Comment (tr|Q3M5P1|Q3M5P1_ANAVT) Peptidase M20D, amidohydrolase {ECO:0000313|EMBL:ABA23695.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_4094 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MAHVLTSEKVFPRMVELRRYLHSHPELAFEEKKTASIVIDELKRLGIPFWYGGVGSGIIG
KLINAGQRAPTIALRADMDALPGQENTGLPFASLHPGKMHACGHDGHMAMVLGAAALLKE
NPPPGNVVFIFQPAEEKGAGAKVMIQSGALEGVNAIFGGHVTRHYQVGEIMVAKGVITAQ
SDGFTIRVKGRGGHGARPHEAVDAVVVAGLLIMAVQTLVSREINPAYPSVVTIGKVEAGS
AGNVIAEEAILEGTIRTTNLDVQNHIIDGLKRIATAVGELHNARVEIEIRHGYPPVINTG
KETEIARRAIVDILGSKGLVTMDYPSMGAEDFSFYLLHVPGCYVRFGACQQGCENIPLHS
PSFDFDEEALKVGAAFFDRVVREAIAEYADNS
Download sequence
Identical sequences A0A1W5CDL5 Q3M5P1
240292.Ava_4094 gi|75910294|ref|YP_324590.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]