SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M5Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M5Z4
Domain Number 1 Region: 3-497
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 6.41e-170
Family Acetyl-CoA synthetase-like 0.00000119
Further Details:      
 
Domain Number 2 Region: 521-597
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000000038
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M5Z4
Sequence length 662
Comment (tr|Q3M5Z4|Q3M5Z4_ANAVT) AMP-dependent synthetase and ligase {ECO:0000313|EMBL:ABA23592.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_3987 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MNISQNVERGCCLFPNKPALIFEGLYFTYKQLNEMANRVANALLGLGIERGDRIALLLPN
IPEFVISYLGILKIGAIAVSINPNLQSDELKFILNDCGAAVLVTTETLREKLPKVDLPHL
KHIIIAEGQAGEAIALSEFMANASPNARAVEIERDEPAAILYTSGTTGFPKGATLSHGNV
ISNMHSMKHCCEMRPNDQILLFLPMFHCFGQNAVLNSGLNTCATIILQRSFDPETVLTTI
SEYNITIFFGVPTTFILLCDKASIRDLDSVRYYFSAAAGLPVEIAKRWQDKFGKVINQGY
GLTETSPLASYNHELRYKLGSIGSPIENVEMKIVSLDDGCEVAPGELGEIVIRGVNVMLG
YWNRPAETAKAMKNGWFHTGDIGQIDELGYFYIVDRLKDMINNGGLKVYPAEVENVIYQH
PGIAEVAVYGVPDSVLGEQVKASIVLKPDQAVTEAEIIAFCYQKLAQYKVPSAVEFVSSI
PKNPTGKILKRLLRQENSAAPSHTVVSKTQTSASVKVSYQTAELIENWIIDWVVRKLAVA
AQSIDQSKSFADYGLDSVRAVKLAQELSEWLGYPLEATIVWNFSTIESLARHLASQKITQ
PTELAKTKPESNLHTENLLVSVELPTNNAEPTESADLKALSDAEIAELLTKEIATVKQRR
LV
Download sequence
Identical sequences Q3M5Z4
gi|75910191|ref|YP_324487.1| 240292.Ava_3987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]