SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M6T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M6T5
Domain Number 1 Region: 4-383
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.72e-97
Family AAT-like 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M6T5
Sequence length 391
Comment (tr|Q3M6T5|Q3M6T5_ANAVT) L-aspartate aminotransferase apoenzyme {ECO:0000313|EMBL:ABA23301.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_3695 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTNFTSRMQAVQSPIIPVVGELIQNSPGTISLGQGVVSYSPPPEAIELLPKFLADPANNL
YKAVEGIPPLLNALTDKLSTFNKMEITTDNCIVVTAGSNMAFMNAILAITSPGDEIILNT
PYYFNHEMAIAMAGCRAVLVETDENYQLRPEAIAQAITPKTRAVVTISPNNPTGVVYCED
LLRNVNQICANCGIYHISDEAYEYFTYDGVKHVSPASFAGSSEYTISLYSLSKAYGFASW
RIGYMVIPKHLLVAIKKVQDTILICPPVVSQYAALGALQAKPEYLQDHIQAIAQVRKIVF
DYLNQLQGLCTITPADGAFYVFLKVHTQIDAFTLVKQLIQEYKVAVIPGTTFGMESGCYL
RVAYGALQKDTVQEGIERLVQGLKTILYPEK
Download sequence
Identical sequences A0A1W5CLQ1 Q3M6T5
gi|75909900|ref|YP_324196.1| 240292.Ava_3695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]