SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M985 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M985
Domain Number 1 Region: 52-508
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.61e-121
Family Pyridoxal-dependent decarboxylase 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M985
Sequence length 522
Comment (tr|Q3M985|Q3M985_ANAVT) L-2,4-diaminobutyrate decarboxylase {ECO:0000313|EMBL:ABA22451.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_2838 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MVIISRSSALPFPQGGAKTQRKKFDELFVAGGSLREAIACAGEVLIDCFATQGKPYSGRS
PQELSRTIADIAVCPDEGVGLRQVLAEVGEKIIKHSVVVTHPTCMAHLHCPPLLPAVAAE
VLISGTNQSLDSWDQSPAATVLEQQVVNWLCASFGYDAGADGIFTSGGTQSNFMGLLLAR
DAYAHRQLNWCVQQQGLPPEAQRFRILCSQVAHFTISQAASLLGLGQQAVVAVETDSDYQ
LCAADVEQKLEQLQQQDLLPIALVATAGTTDFGSIDKLPELAACAEKYGLWFHVDAAFGG
ALVMSDRHRDKLDGIALADSITVDFHKLFYQPISCGAFLVKQHQNFDLIKLHADYLNPET
NEIASIPDLVTKSIQTTKRFDALKLFVSLRTLGRRQFADMIDTTIELAKETANLIDAEPA
LELANNPTINAVVFRYLPSETPAHLDSTTWANQINSHIRMSLLQQGIAVIAQTKIGQLTY
LKFTLLNPQTAIADIQEVLNSITTIGEKHLFHPQESQEGLSL
Download sequence
Identical sequences Q3M985
gi|75909050|ref|YP_323346.1| 240292.Ava_2838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]