SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M9A4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M9A4
Domain Number 1 Region: 4-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-107
Family GABA-aminotransferase-like 0.00000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3M9A4
Sequence length 386
Comment (sp|Q3M9A4|BIOF_ANAVT) 8-amino-7-ketopelargonate synthase KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=bioF; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MPDPYAWLQNSLLTIHRADWYRSVQTIQGRAGASVVLGGKEVINFASNDYLGLAGDERLI
AAAVAATQEFGTGSTGSRLLSGHRELHGELEKAIASWKQTEDALVFSSGYLANIGAIAAL
VGKRDLILSDQYNHSSLKNGAILSGATVREYSHCEVGELKTQLLEQRQNYRRCLILTDSV
FSMDGDLCPLPALLDLAEQFSCMLLVDEAHATGVMGKTGAGCVEHFGCTGRQLIQIGTLS
KALGSLGGYVAGSHPLIDYLRNRAPSWIYTTGLSPADTAAALAAINIAQQEPQHRMQLWH
NVNYLRELLQKIPNLKLLPSASPILCFQLSSPSEALQVGKQLKQAGIFAPAIRPPTVPTS
RIRISLMATHKPAHIEKLVAVLADIS
Download sequence
Identical sequences A0A1W5CJ64 Q3M9A4
240292.Ava_2819 gi|75909031|ref|YP_323327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]