SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3M9J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3M9J6
Domain Number 1 Region: 174-489
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.16e-114
Family Leucine aminopeptidase, C-terminal domain 0.000000456
Further Details:      
 
Domain Number 2 Region: 1-177
Classification Level Classification E-value
Superfamily Macro domain-like 2e-37
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3M9J6
Sequence length 491
Comment (sp|Q3M9J6|AMPA_ANAVT) Leucyl aminopeptidase {ECO:0000255|HAMAP-Rule:MF_00181} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_2727; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MAIQLSDKPLLEWAGDTLAIALFEDAVELTGELASLDEKFAGILKELIAEEEFTGKANST
VFTRVSANIPVRKIILVGLGKTEAFNIDTLRRAAAAVGKVGKKQKSKVIGLSFPLWNNDP
TASSQAIAEGVQLALYQDNRFKSDPDDKGSQVETVELLGFAGQEAAINRANQIVSGVILA
RQLVAAPANSVTPITMAETAQQIAQDYGLQIEILEQEDCEKLGMGAFLGVALASDLPPKF
IHLTYKPESTPKRKLAIVGKGLTFDSGGLNIKGAGSGIETMKIDMGGAAATLGAAKAIAQ
IKPNVEVHFISAVTENMISGKAMHPGDILTASNGKTIEVNNTDAEGRLTLADALVYTDKL
GLDAIVDLATLTGANVIALGDDIAGLYTPDDALAGQLEQAASESGEKIWRMPLEEKYFEG
LKSGIADMKNTGPRPGGSITAALFLKQFVKDTPWAHLDIAGPVWADKENGYNGPGATGYG
VRLLVDWVLSE
Download sequence
Identical sequences A0A1W5CQE8 Q3M9J6
240292.Ava_2727 gi|75908939|ref|YP_323235.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]