SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MAX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MAX6
Domain Number 1 Region: 32-366
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.42e-62
Family AAT-like 0.0000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MAX6
Sequence length 380
Comment (sp|Q3MAX6|HIS82_ANAVT) Imidazole acetol-phosphate transaminase 2 {ECO:0000255|HAMAP-Rule:MF_01023} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_2242; OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLPFIRSDLAQFTAYKPHPSSDTDAAVPAQLDRLDTNESPCDLPPELKQKLAWTFQQVIE
SNRYPDGGHEELKDAIAQYVNESANISSSPITAANISVGNGSDELIRSLLIATCLGAQGS
ILVANPTFSMYGILAQTLGIPVVTVSRNPENFEIDLTAAQSAIEQTQNPPIRVVFVVHPN
SPTANPLTTNELRWLKSLSEQILVVVDEAYFEFSQTTLISELVQRPNWVILRTFSKAFRL
AAMRVGYCVAHPEAIAILEKVRLPYNLPSFSITSALVALQNRAILLESIPQILNERAKLI
TALSKYPELAVAESAANFIFLQLKTDNKNSPDTALLNLHQQLKNSGTLVRQISGGLRITI
GTPEENIRTLNHIQTALIKA
Download sequence
Identical sequences A0A1W5CN66 Q3MAX6
gi|75908459|ref|YP_322755.1| 240292.Ava_2242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]