SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MB59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MB59
Domain Number 1 Region: 7-384
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.26e-94
Family GABA-aminotransferase-like 0.03
Further Details:      
 
Domain Number 2 Region: 343-484
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 8.37e-33
Family Ornithine decarboxylase C-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3MB59
Sequence length 488
Comment (tr|Q3MB59|Q3MB59_ANAVT) Arginine decarboxylase {ECO:0000313|EMBL:ABA21777.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_2157 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLDQNQTPLIDGIKACIARPHAAFYTPGHKRGRGIAQPLADLLGEAVFGADLTELANLDN
LSAPQGVIQEAQRLAAAAFGAAQTWFLVNGSTCGVEAAIMATCRPGDKIILPRNVHSSAI
AGLILSGAIPIFIHPEYDQVLDIAHSMTPEAVKAALQQHPDAKAVLAVYPTYYGVCGDLE
AIAQITHQYNIPLLVDEAHGAHFTFHPELPTPALAAGADLTVQSIHKVLGAMTQASMLHI
QGDRINAVRVSQALQLLQSTSPSYVLLASLDAARQQMALCGKQLMSRTLQLANEARERIS
QIPGLSVLQPPTMTPSSGFTTLDKTRLTITVSGLGLTGFAAEEILDEQLGVTAEFATFKH
LTFIISLGNTTADIEQLVQGFTTLAETTPPAKALVNPRVNSNLEYFSEISPRDAFFADSE
TLSIEQARDRICAEIICPYPPGIPVIMPGEVITKPAIEYLQHIQSSGGFITGCADTSLST
LKVLVIGH
Download sequence
Identical sequences A0A1W5CG42 Q3MB59
240292.Ava_2157 390461 gi|75908376|ref|YP_322672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]