SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MBY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MBY2
Domain Number 1 Region: 31-426
Classification Level Classification E-value
Superfamily Pectin lyase-like 9.43e-56
Family Pectate transeliminase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MBY2
Sequence length 428
Comment (tr|Q3MBY2|Q3MBY2_ANAVT) Parallel beta-helix repeat protein {ECO:0000313|EMBL:ABA21504.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_1882 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTKNPVRNICLVVVTALTFTAVSSGEIGKAQISGKTYYVDQGTGSDYNSGTTQTSAFKTI
NKANQIVAAGDTIYVKNGTYQENITVKKSGTPDKWISLQAYPGQTPKVRGTQDGSISVEG
SYVKVIGFDVTSSGEGSAINVGRGNHHVHIIRNIVHDSGCGGISAQETDYLTIEENISYR
NAFRSGYMCSGISIYQAKAFDDAPGFHNIIRGNISYANENKVTTSWGGRSFVTDGNGIII
DDFRQTQSQRFRPRYTPWTLIENNIVFNNGGRGIHIYESDNVVVRNNTAFKNLRSGNLDG
HLNGELTTYFSSNIHFYNNIAYSSSLNKKTFVDDYSSKNRWDNNLSYIGSTLVNDGHSDV
KLGANNRINVNPLFINASTDPKLANFRLNLGSPAIDSGTTQSAASVDFDKNARPFGVGPD
MGAFELRR
Download sequence
Identical sequences Q3MBY2
gi|75908103|ref|YP_322399.1| 240292.Ava_1882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]