SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MCQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MCQ0
Domain Number 1 Region: 1593-2157
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.14e-165
Family Acetyl-CoA synthetase-like 0.0000000021
Further Details:      
 
Domain Number 2 Region: 495-1084
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.53e-165
Family Acetyl-CoA synthetase-like 0.000000007
Further Details:      
 
Domain Number 3 Region: 260-525
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.45e-71
Family NRPS condensation domain (amide synthase) 0.035
Further Details:      
 
Domain Number 4 Region: 1359-1623
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.22e-71
Family NRPS condensation domain (amide synthase) 0.057
Further Details:      
 
Domain Number 5 Region: 3234-3497
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.06e-65
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.00053
Further Details:      
 
Domain Number 6 Region: 76-253
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 3.34e-52
Family NRPS condensation domain (amide synthase) 0.0067
Further Details:      
 
Domain Number 7 Region: 2882-3135
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 2e-50
Family NRPS condensation domain (amide synthase) 0.02
Further Details:      
 
Domain Number 8 Region: 1162-1351
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.09e-48
Family NRPS condensation domain (amide synthase) 0.014
Further Details:      
 
Domain Number 9 Region: 2704-2881
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 8.23e-46
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 
Domain Number 10 Region: 2413-2665
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.11e-44
Family NRPS condensation domain (amide synthase) 0.021
Further Details:      
 
Domain Number 11 Region: 2229-2405
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.67e-37
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 
Domain Number 12 Region: 1063-1172
Classification Level Classification E-value
Superfamily ACP-like 1.13e-23
Family Peptidyl carrier domain 0.0013
Further Details:      
 
Domain Number 13 Region: 3162-3235
Classification Level Classification E-value
Superfamily ACP-like 3.8e-21
Family Peptidyl carrier domain 0.0012
Further Details:      
 
Domain Number 14 Region: 2138-2208
Classification Level Classification E-value
Superfamily ACP-like 7.72e-17
Family Peptidyl carrier domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3MCQ0
Sequence length 3498
Comment (tr|Q3MCQ0|Q3MCQ0_ANAVT) Non-ribosomal peptide synthase {ECO:0000313|EMBL:ABA21236.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_1613 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MNIEQLVFDLNQKGVKLWVEGEQLRANAPKGVLTLETRDLLAKNKAELISLLHEKTTNTN
KDLSLITTERPQHLPLSFAQEQLWLLNQLEPNNPFYNEQVALKLHGQLNIVALEQSLNIV
VARHEVLRTNFHTINEQPVQVIADSLNLSLPIVDLTHLPVNEREIACQKLASQEANHPFD
LVNSPLVRASVIKLTEVEHALLITIHHIIFDGWSMGVLMGELATIYSALCNSSSPNLPEL
PIQYADFAIWQRQRLQKEALQTQLDYWKQQLKNAPNLLELPTDRPRPAIQTYRGATHYVE
LSNELSQALTQFSRQEGATLFMTLFTAYATLLHRYTGQDDIVVGTPLANRDRLELEGLIG
FFVNTLVLRADLSGNPSFQELLSRVRRVTLQAYTHPDLPFEELVKALQPQRDLSHTPLFQ
VMFVLENAPTSEAELAGLTLSPLGTQRTTAKFDLTLFIKNTPSGLLAIWQYNTDLFDSST
IERMAGHFVTLLAGVVANPQQQISQLPLLTQVEQQQLLVEWNNTQVNYPPHQSISQLFEE
QVQRTPDAVAVEFGNQQLTYSQLNSRANQLAHYLRSLGVKPDVLVGLCVERSLEMVVGLL
GILKAGGAYLPLDPEYPTERLSFMLEDAQVSVLLTQQLLLDRLPSYEKAGEQGAGEQGEK
LLTTYQAQLVCLDTDWQLISHSSQENPITDVQADNLGYVIYTSGSTGKPKGVAMNQLSLC
NLILWQLQNTKISHGAKTLQFAPISFDVSFQEIFSTWCSGGTLLLITEELRRDALALLGL
IQEKAVARLFLPFVALQQLAEVAVDSGLVNSHLKEIITAGEQLQITPVIAQWFSQLNHCT
LHNNYGPSETHVATNFTLDNSVETWPLLPPIGKPITNTKIYILDNYLQPVPIGVPGELYI
GGVSLARGYLKRPELTQEKFIPNPFEQGQGSRLYKTGDLARYLPDGNIEYLGRIDNQVKI
RGFRIELGEIEAALSQYRDVQAACIIPREDTPGDKRLVAYVVAHQDSTTTMGELRQFLKA
KLPEYMVPSTFVMLDALPLTPSGKLDRRALPAPDLDNEITDKYVAPRNPTEELLAQIWAQ
VLKVEKVGIHDNFFDLGGHSLLATQLISRIRNVFKVELPLRELFASATISELARSLEQLQ
QNDLELSAPPIVPRTKNTDLPLSYAQQRLWFLDQFEPNSPSYNIPVALRLVGTLNQAALE
QSLQDIIHRHEALRTNFVTVEEKATQVIWGLGTGDWGLGTGDWGLGIISVVDLQHLPTTE
QESVLQDLAQEQGQISFNLANEPLIRVTLVVLSETEHALFVCMHHIVSDGWSMGVFVQEL
AALYDAYSEDRQSPLTPLAIQYADFAIWQRDWLQGDVLQKQLSYWQQQLANAPTLLSLPT
DRPRPSVQTFPGAYQEFALSVELTQKLVTLSQEQGCTLFMTLLAAYDTLLYRYTGQSDIL
VGSPIANRDRLEVEGLIGFFVNSLVMRTNLAGNPSFYELMGRVRDMAMDAYAHQDLPFEM
LVEALQPERDLSHTPLFQVMFVLQNTPMSPIELTGLTVTPLVIKGSTAKFDLTLSMQNTD
TGLVGAWEYNTDLFDASTIERMAGHFVTLLEGIVTNPQQRISQLPLLTAVEQQQLLVEWN
NTQVEYPIDKCLHQLFEEQVQRTPHAVAVEYENQQLTYDQLNRRANQLAHYLQSLGVKPE
VLVGICVERSLDTVVGLLGILKAGGAYVPLDPNYPVERLSYMLADSQLPILLTQKHLLKQ
LPNNQTQTICLDEDWQKLANYSDENPCSQVKSDNLAYIIYTSGSTGKPKGTMIVHRGVVN
YLSWCTKAYDVAAGVGSTVNSSLSFDATITSLFSPLLVGAKVLLLPEEEEIEALKTALCS
GTKFSLVKITPAHLEILSHLFTSEAVNIQAQAFIIGGEALSEKIASFWKKRAPETKLINE
YGPTETVVGCCIYEVEKLGYPGSNIPIGRPIANTQLYILDSHLQPVPIGVPGELYIGGDG
VARGYLNRPELTQQKFIPNPFEKSQGSRLYKTGDLARYLSDGNIEYLGRIDDQVKIRGFR
IELGEIAAVLNTHPQVKQAVMIVTEDIHGNKRLVAYVVTSDESLSTNQLRQFLKQQLPEY
MIPSGFVTLESIPLTPNGKIDRKALPTPDGEIYRESEYVAPRTPIEQTLTNIWQQLLLKE
KVSIHDNFFEIGGDSILSIQVVSRAKNAGIQITPKQIFQNQTIAELAQVANTTVSVESKQ
GVVTGIAPLTPIQHWFFEQNQQDSHHYNQSVLLQVPNNLQSELIAIAVQKLLEHHDALRL
KFTSVADEYKQTNQGLDDSVPFTVVDLSSVPKDEQAQTLEKIAAKYQASLDLATGAIMQT
VMFNLGNDSDARLLIIVHHLAVDGVSWRILLSDLEEIYQQLITPKPVDLSAKTTAFIDWA
EKLNNYAQSATIKDELDYWLNQSWSEITPLPLDYGDIPQENTVGNSDCVSVILSHQETQS
LLLSANEAYNTQINDILLSALAISITEWTGNSTVIVDLEGHGREELFADVDLSRTVGWFT
SLFPVLLQLPAYKQTGEIIKSIKEQLRAIPHRGIGYGILRYLCKDSNVKEKIQTVPTAEI
SFNYLGQFDQVQSETGWKFAPETTGSVQSLKQTRNHLLDINALVIDGKLRIEWTYNSHVH
ARSTVEKLAQSYLQAIASIIEHCQLAENRGFTPSDFPDAQLNQSQLDELLTHFPSHNIES
IYQLSPSQQGMLFETLAASASGIHLEQCILNLQTEVDVLAFAKAWQRVSDRHSILRTAFV
WENQNEPLQVVLKQVELPLEQQDWRGLSPSQQQEKLETYVSADRLHGFDMTQAPLMRLAL
FQVASNAYQFVWTSHHILTDGWSTPLIFQEVFALYTAFSKGQDLSLKPSHPYRNYIAWLK
QQDLSQAEAFWRNKLQGFKSPTPLGIEAEPMTFSDGEERYGEQKARLSASATAALQSLVR
KHHLSLNILVQGVWGLLLSRYSGLEDVVFGATFSGRPPELVGSESMLGLFINTLPMRLLV
PSQASLWSWLKDIQEQNFTQRDYEYCSQGQIHEWSEVPGSLPLYESLLVFQNYPVDPSVI
QSANHDNQQSQDRSIGAQTKYALTILVSPTSQLEFRIIYQRSRYDHPAINLILEHFQALL
NSIVDLPEQSLATLIARISPEQVPQVRGLPKLIHKEQRKAFNAPRNLWEFQLVQIWEDIL
GIHPVSVQDNFFELGGHSLLAVRLVSRIQKHFQINLPLSILFQYPTIEQLSSFLDSPTDT
LSWSALVPIRSNGNLSPIFCVHPGGGNVLCYHHLAYYLSPERPFYGLQCVGLNPKNQPHT
SIEQMATHYIKELQTVQPHGPYFLSGWSFGGLVAFEMAQQLSRQGEQIALLALLDTTPPA
LSYRGEIDYAFLLVELFKDQLELCLEELRQFAPEEQITYVVEQAKQKNIFIETFDFDQAP
HLLKILQINAQALQNYQPQSYSGSIVLLKAAETEEDFESSWKQLVEQIETVVVPGNHISM
MSPPHIQNLVQKIQDFLE
Download sequence
Identical sequences Q3MCQ0
240292.Ava_1613 gi|75907835|ref|YP_322131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]