SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MFV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MFV1
Domain Number 1 Region: 11-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.38e-61
Family PP-loop ATPase 0.00019
Further Details:      
 
Domain Number 2 Region: 214-332
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 6.02e-20
Family MesJ substrate recognition domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MFV1
Sequence length 342
Comment (tr|Q3MFV1|Q3MFV1_ANAVT) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_0511 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MVWTKLHAKIHRTIRSRHLFERNQRLLVAVSGGQDSLCLIKLLLDLQLKWGWELGIAHCD
HRWRVDSQANADHVKNLSETWGVSFYLETASKPINSEATAREWRYETLSAIAQAYNYEYI
VTGHTASDRAETLLYNLMRGTGADGLQALTWQRPLTENILLVRPLLEITRKQTEQFCQEF
QLPIWEDSTNQDLKYARNRIRQELIPYLQANFNPQAELAIAQTAELLQADVEYLERTAQQ
LKEKAMEWEVGEEFLSPSSPSPFLLRLNRQVLQKAPLALQRRVMRQVLQEILADAPNFEH
IEKLTALITAPNRSQTDPFPGGAIAQVQDNWILFRNGERRNN
Download sequence
Identical sequences A0A1W5CPD3 Q3MFV1
240292.Ava_0511 gi|75906734|ref|YP_321030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]