SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MG33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MG33
Domain Number 1 Region: 11-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.66e-132
Family Cystathionine synthase-like 0.0000000000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MG33
Sequence length 420
Comment (tr|Q3MG33|Q3MG33_ANAVT) Cysteine desulfurase {ECO:0000256|SAAS:SAAS00645443} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_0427 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MTYTPTKTLADKVRADFPILREEVNGKTLVYLDNAATSQKPLFVLNALRDYYEQYNSNVH
RGAHTLSAKATDAYEGARDKIAKFINAASRQEIVYTRNASEAINLVAYSWGMNNLQAGDE
IILSVMEHHSNIVPWQFVAQKTGAVLKFVELTPEQTLDMEQFKQLISEKTKLVSIVHVSN
TLGCINPVAEIAEITHRYGAKFLVDACQSVPHMPIDVQQIDCDWLVASGHKMCAPTGIGF
LYGKLALLEAMPPFFGGGEMIAEVYLDHSTYAELPHKFEAGTPAIGEAIALGAAIDYLTD
IGMDKIHAYEAELTAYLWQKLEQIPQITLYGPTPDAHGGGRAALATFTIEGIHANDLSTL
LDQEGVAIRSGHHCTQPLHRHLGLAGTARASLSFYNTREEIDVFIKALKETIDFFAGIFG
Download sequence
Identical sequences A0A1W5CFI8 Q3MG33
gi|75906652|ref|YP_320948.1| 240292.Ava_0427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]