SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MGP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MGP6
Domain Number 1 Region: 39-430
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.35e-130
Family GABA-aminotransferase-like 0.000000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MGP6
Sequence length 431
Comment (tr|Q3MGP6|Q3MGP6_ANAVT) 4-aminobutyrate aminotransferase apoenzyme {ECO:0000313|EMBL:ABA19840.1} KW=Complete proteome OX=240292 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937). GN=Ava_0214 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Trichormus.
Sequence
MLSIPINQHLPHTPHLVTSLPGPRAKAIVERDRAVTSPSYTRDYPLVVNRGEGCMVEDVD
GNVFLDMTAGIAVTATGHAHPEVVRAIQEQSARLIHMSGTDFYYEPMVELAENLASQAPF
VHDTKVFFTNSGAESNEGAIKLARYYTKRSLIIAFLGAFHGRTYGAMSLTGSKTVQRANF
GPLVPGVTHIPYGTHASLDYLENNLLTTIIPAHEVAAIVVEPIQGEGGYIVPEDGFLQRI
RNICDRYGILMVVDEVQSGMGRTGRLFAIEHWNVTPDIITTAKGIASGMPLGAILARAEL
MTWPPGSHATTFGGNPVACAAGIVTLKLLESGLMDNATQMGELLQTGLTQLHQQFPRMSL
PRGKGLMVAVDLLDEDGNFDSKLRDRIIQEAFYHGLLLLGCGKAAIRFCPPLVINREQIQ
TTLDILAEILR
Download sequence
Identical sequences A0A1W5CJL5 Q3MGP6
gi|75906439|ref|YP_320735.1| 240292.Ava_0214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]