SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3MHG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3MHG3
Domain Number 1 Region: 10-160
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.7e-41
Family Multidomain sulfurtransferase (rhodanese) 0.00000776
Further Details:      
 
Domain Number 2 Region: 166-283
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.85e-34
Family Multidomain sulfurtransferase (rhodanese) 0.00000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3MHG3
Sequence length 297
Comment (tr|Q3MHG3|Q3MHG3_BOVIN) Sulfurtransferase {ECO:0000256|RuleBase:RU000507} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=MPST OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MASKQLFRALVSAQWVAEALRAPQAGQPLRLLDASWYLAKLGRDARREFEERHIPGAAFF
DIDQCSDRTSPYDHMLPSAAHFSEYAGRLGVGAATHVVVYDASDQGLYAAPRVWWMFRVF
GHRTVSLLDGGLRNWLRQGLPLSSGKSRPQPAEFHAVLDPAYIKTYEDIKENLESRRFQV
VDARAAGRFRGTEPEPRDGIEPGHIPGTINIPFTDFLTEDGLEKSPEEIRRLFQDKKVDL
SLPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRAQPEDIISEGRGKIH
Download sequence
Identical sequences Q3MHG3
ENSBTAP00000040892 ENSBTAP00000040892 9913.ENSBTAP00000040892 9913.ENSBTAP00000047128 NP_001231253.1.59421 NP_001231253.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]