SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3SZW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3SZW0
Domain Number 1 Region: 1-236
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0039
Further Details:      
 
Domain Number 2 Region: 312-413
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000179
Family FAD/NAD-linked reductases, N-terminal and central domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3SZW0
Sequence length 429
Comment (tr|Q3SZW0|Q3SZW0_BOVIN) Flavin-containing monooxygenase {ECO:0000256|RuleBase:RU361177} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=FMO3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MVKKVAIIGAGISGLASIRNCLEEGLEPTCFEKGEDIGGLWKFSDHVEEGRASIYRSVFT
NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFQ
TTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGKCFHSRDYKEPG
IFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFE
TFLKNTLPTVISNWWYMKQMNARFKHENYGLMPLNSTLRKEPVFNDELPACILCGIVTIK
PNVKEFTEDSAIFEDGTVFKAIDYVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPP
LEKPTLAVIGLVQSLGAAIPTTDLQSRWAVQVIKGTCPLPSVKDMMNDIDEKMGKKLKLQ
FLLFPGQDK
Download sequence
Identical sequences Q3SZW0
ENSBTAP00000027198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]