SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3SZZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3SZZ0
Domain Number 1 Region: 61-246
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000000226
Family Brix domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3SZZ0
Sequence length 353
Comment (sp|Q3SZZ0|BRX1_BOVIN) Brix domain-containing protein 2 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=BRIX1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAATKRKRRGGLAVQAKKLKRDAKDGKLPAKANDVSEEAAEEEKDRIPGPVCKGKWKNKE
RILIFSSRGINFRTRHLMQDLRMLMPHSKADTKMDRKDKLFVINEVCEMKNCNKCIYFEA
KKKQDLYMWLSNSPHGPSAKFLVQNIHTLAELKMTGNCLKGSRPLLSFDPAFDELPHYAL
LKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAALVEIGPRFVLNL
IKIFQGSFGGPTLYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTILPH
DPTADVFVTPAEEKPVEIQWVKPEPKVDLKARKKRIYKRQRKMKQKMSSGNAK
Download sequence
Identical sequences Q3SZZ0
NP_001029701.1.59421 NP_001029701.1.76553 XP_010852118.1.44457 XP_019838563.1.53367 ENSBTAP00000025572 ENSBTAP00000025572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]