SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3T0E8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3T0E8
Domain Number 1 Region: 5-146
Classification Level Classification E-value
Superfamily EF-hand 2.8e-36
Family Calmodulin-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3T0E8
Sequence length 153
Comment (sp|Q3T0E8|CALL4_BOVIN) Calmodulin-like protein 4 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CALML4; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLTVMRCLGASPTPGEAQRHLQTHRIDR
NGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMQLGEKLTHK
EVEDLFREAGIEPNGKVKYDEFIQKLTIPVRDY
Download sequence
Identical sequences Q3T0E8
NP_001029843.1.59421 NP_001029843.1.76553 ENSBTAP00000036380 ENSBTAP00000036380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]