SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TCW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TCW6
Domain Number 1 Region: 211-403
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.45e-60
Family Hemopexin-like domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.67e-57
Family Matrix metalloproteases, catalytic domain 0.00000131
Further Details:      
 
Domain Number 3 Region: 1-31
Classification Level Classification E-value
Superfamily PGBD-like 0.00000000000353
Family MMP N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3TCW6
Sequence length 403
Comment (tr|Q3TCW6|Q3TCW6_MOUSE) Matrix metalloproteinase {ECO:0000256|RuleBase:RU364080} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Mmp12 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMK
REDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFY
PGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPS
TFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFF
WWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPR
SIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIK
PKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC
Download sequence
Identical sequences Q3TCW6
ENSMUSP00000114129 NP_001307006.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]