SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TCX3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TCX3
Domain Number 1 Region: 234-329
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 123-187
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000142
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3TCX3
Sequence length 612
Comment (sp|Q3TCX3|KHDC4_MOUSE) Pre-mRNA splicing factor protein Khdc4 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Khdc4; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSAGSATHPAAGGRRSKWDQPAPAPLLFLPPTAPGGEVAGSGASPGGATTAAAPSGALDA
AAAVAAKINAMLMAKGKLKPSQNAAEKLQAPGKSLTSNKSKDDLVVAEVEINDVPLTCRN
LLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRI
KEIITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAINQKPSFQSGMHYVQDKLFVG
LEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYIS
HPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSIPPQPPYYPSN
GYQSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPA
STGQSPISAPFIPAAPVKTALPTGPQPQPQLPAQPQSQKRRFTEELPDERDSGLLGYQHG
PIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNGSG
ALAGSHDYPAKKMKTAEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSSQP
RAKQQMPFWMAP
Download sequence
Identical sequences Q3TCX3
NP_083090.2.92730 10090.ENSMUSP00000029696 ENSMUSP00000029696 ENSMUSP00000029696 ENSMUSP00000029696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]