SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TRQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TRQ4
Domain Number 1 Region: 46-156
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-28
Family Carbonic anhydrase 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3TRQ4
Sequence length 169
Comment (tr|Q3TRQ4|Q3TRQ4_MOUSE) Carbonic anhydrase 10, isoform CRA_b {ECO:0000313|EMBL:EDL15897.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_1462 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGG
PMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVCAPAKVLRHRANL
Download sequence
Identical sequences Q3TRQ4
ENSMUSP00000103493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]