SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TVF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TVF4
Domain Number 1 Region: 11-322
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.75e-112
Family Protein prenyltransferases 0.0000000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3TVF4
Sequence length 331
Comment (tr|Q3TVF4|Q3TVF4_MOUSE) RAB geranylgeranyl transferase, b subunit, isoform CRA_a {ECO:0000313|EMBL:EDL11897.1} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=mCG_7369 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLM
GQLHRMNREEILVFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSVHVINVDKVV
AYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Download sequence
Identical sequences Q3TVF4
NP_001156950.1.92730 ENSMUSP00000087396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]