SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3TWC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3TWC1
Domain Number 1 Region: 105-266,361-667
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-124
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 782-876
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.46e-41
Family Ras-binding domain, RBD 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3TWC1
Sequence length 907
Comment (tr|Q3TWC1|Q3TWC1_MOUSE) Ral guanine nucleotide dissociation stimulator {ECO:0000313|Ensembl:ENSMUSP00000097812} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Ralgds OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MVQRMWAEAAGPIGGTEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSRYGCIL
PYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREPAAAPV
PVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPALEPSWS
LPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLA
PTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSLYAILS
ALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNP
RRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKL
LQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKSTAIVKR
WSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEINMSFV
PESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGVCSYSS
SLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDEPEDYE
LVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRMKQKGL
RIAKGIF
Download sequence
Identical sequences Q3TWC1
ENSMUSP00000097812 NP_001139307.1.92730 ENSMUSP00000097812 ENSMUSP00000115092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]