SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3U1V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3U1V8
Domain Number 1 Region: 109-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-78
Family Protein kinases, catalytic subunit 0.0000147
Further Details:      
 
Domain Number 2 Region: 46-127
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-21
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  Q3U1V8
Domain Number - Region: 415-483
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00247
Family Regulator of G-protein signaling, RGS 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3U1V8
Sequence length 1077
Comment (sp|Q3U1V8|M3K9_MOUSE) Mitogen-activated protein kinase kinase kinase 9 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Map3k9; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MESSRSLLGCLASATAAPPGDDATGAGAEEEEDEEEAAAELGSHAALPYWTAVFEYEAAG
EDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPGAED
PSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWAGDEVAVKAARHDPDEDISQTIEN
VRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVNWAV
QIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRTTKM
SAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMNKLA
LPIPSTCPEPFAKLMEDCWNPDPHSRPSFTSILDQLTTIEESGFFEMPKDSFHCLQDDWK
HEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILERELNII
IHQLCQEKPRVKKRKGKFRKSRLKLKDGNRISLPSDFQHKFTVQASPTMDKRKSLISNRS
SPPASPTIIPRLRAIQLTPGESSKTWGRSSVVPKEEGEEEEKRAPKKKGRTWGPGTLGQK
ELTSGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLMEIEDEDSEGPGSGENHQ
QHSPNQSYLCIPFPRGEDGDGPSSDGVHEEPTPVNSATSTPQLTPTNSLKRGGTHHRRCE
VALLGCGAVLAATGLGFDLLEAGKCQLLPPEEPEPPAREEKKRREGLFQRASRPRRSTSP
PSRKLFKKEEPMTLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSPVEAP
PLTQCTHNPLVNVRVERFKRDPNQSLTPTHVTLTAPTQPSGHRRTPSDGALKPTAAPAVL
GSRSPSSNGMSPSPGTGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQRDSTLERPK
TLEFLPRPRPSANRQRLDPWWFVSPSHARSASPANSSSTETPSNLDSCFASSSSTVEERP
GLPALLPLQAGPLLPAERTLLDLDAEGQSQDSTVPLCRAELNAHGPSPYEIQQEFWS
Download sequence
Identical sequences Q3U1V8
ENSMUSP00000041819 ENSMUSP00000041819 NP_001167578.1.92730 10090.ENSMUSP00000041819 ENSMUSP00000041819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]