SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UCJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UCJ0
Domain Number 1 Region: 245-525
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-102
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000144
Further Details:      
 
Domain Number 2 Region: 4-107
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-28
Family SH2 domain 0.0000117
Further Details:      
 
Domain Number 3 Region: 94-215
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-25
Family SH2 domain 0.0000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3UCJ0
Sequence length 597
Comment (tr|Q3UCJ0|Q3UCJ0_MOUSE) Tyrosine-protein phosphatase non-receptor type {ECO:0000256|PIRNR:PIRNR000929} OX=10090 OS=Mus musculus (Mouse). GN=Ptpn6 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MLSRGWFHRDLSGPDAETLLKGRGVPGSFLARPSRKNQGDFSLSVRVDDQVTHIRIQNSG
DFYDLYGGEKFATLTELVEYYTQQQGILQDRDGTIIHLKYPLNCSDPTSERWYHGHISGG
QAESLLQAKGEPWTFLVRESLSQPGDFVLSVLNDQPKAGPGSPLRVTHIKVMCEGGRYTV
GGSETFDSLTDLVEHFKKTGIEEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESED
TAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKSKNRYKNILPFDHSRVILQGRDSNIPG
SDYINANYVKNQLLGPDENSKTYIASQGCLDATVNDFWQMAWQENTRVIVMTTREVEKGR
NKCVPYWPEVGTQRVYGLYSVTNSREHDTAEYKLRTLQISPLDNGDLVREIWHYQYLSWP
DHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRTGTIIVIDMLMESISTKGL
DCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTKKKLEIIQSQKGQESEYGN
ITYPPAVRSAHAKASRTSSKHKEEVYENVHSKSKKEEKVKKQRSADKEKNKGSLKRK
Download sequence
Identical sequences Q3UCJ0
ENSMUSP00000108103 ENSMUSP00000129124 ENSMUSP00000004377 ENSMUSP00000129124 NP_001071173.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]