SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UEJ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UEJ8
Domain Number 1 Region: 8-219,325-383
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.78e-46
Family FAD-linked reductases, N-terminal domain 0.0000948
Further Details:      
 
Domain Number 2 Region: 222-325
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 7.06e-25
Family D-aminoacid oxidase-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3UEJ8
Sequence length 390
Comment (tr|Q3UEJ8|Q3UEJ8_MOUSE) Pipecolic acid oxidase {ECO:0000313|EMBL:EDL12896.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_10817 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MAAQTDFWDAIVIGAGIQGCFTAYHLAKHSKSVLLLEQFFLPHSRGSSHGQSRIIRKAYP
EDFYTMMMKECYQTWAQLEREAGTQLHRQTELLLLGTKENPGLKTIQATLSRQGIDHEYL
SSVDLKQRFPNIRFTRGEVGLLDKTGGVLYADKALRALQHIICQLGGTVCDGEKVVEIRP
GLPVTVKTTLKSYQANSLVITAGPWTNRLLHPLGIELPLQTLRINVCYWREKVPGSYGVS
QAFPCILGLDLAPHHIYGLPASEYPGLMKICYHHGDNVDPEERDCPKTFSDIQDVQILCH
FVRDHLPGLRAEPDIMERCMYTNTPDEHFILDCHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLPPSYDLAPFRMSRFSTLSKAHL
Download sequence
Identical sequences Q3UEJ8 Q9D826
ENSMUSP00000017597 ENSMUSP00000017597 ENSMUSP00000017597 NP_032978.2.92730 10090.ENSMUSP00000017597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]