SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UEU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UEU3
Domain Number 1 Region: 64-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 272-386
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000236
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 474-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 231-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000089
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 435-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  Q3UEU3
Domain Number - Region: 385-433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00233
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3UEU3
Sequence length 638
Comment (tr|Q3UEU3|Q3UEU3_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE28818.1} OX=10090 OS=Mus musculus (Mouse). GN=Lrp3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEKRAAAGPEGAPGARAPLAVVCLVNLFLTGRLSSAVPALGKAGATWGFGFQAATEPTGT
QAACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQC
SLDWLLLGPAAPPRQEAFRLCGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRG
KLGQTSCQTDEFRCDNGKCLPGPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPC
SGARSTRCLPVERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSD
LHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAA
QGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSEGDDDSTGEQGCFSEPQRCDG
WWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTF
HCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAF
KLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQNTPRK
KMGTPVRIMMMPTPQTMGSEMKLKTSRNAQNTKYTTGD
Download sequence
Identical sequences Q3UEU3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]