SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3UEV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UEV4
Domain Number 1 Region: 44-157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-28
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 2 Region: 252-366
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000034
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 454-491
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 165-202
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 211-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 415-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000236
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  Q3UEV4
Domain Number - Region: 365-413
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00331
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3UEV4
Sequence length 770
Comment (tr|Q3UEV4|Q3UEV4_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE28807.1} OX=10090 OS=Mus musculus (Mouse). GN=Lrp3 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
VVCLVNLFLTGRLSSAVPALGKAGATWGFGFQAATEPTGTQAACSGKLEQHTERRGVIYS
PAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRL
CGSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQTSCQTDEFRCDNGKCL
PGPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQD
CGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLE
LRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFN
ATYQVKGYCLPWEQPCGSSEGDDDSTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQAAPGPVPEPPAPNTDTGSP
REAGDGPPSGSGHAPEVGPSVPPPPLNLRDPEYRPEDKERKACVEPLEDSPAPVDTPPEP
CLAQDPHPQTPTASGTQDPHSAEPLGVCRSPPPPCSPILEASDDEALLVC
Download sequence
Identical sequences Q3UEV4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]