SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UP78 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UP78
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.015
Further Details:      
 
Domain Number 2 Region: 271-372
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000497
Family Scavenger receptor cysteine-rich (SRCR) domain 0.021
Further Details:      
 
Weak hits

Sequence:  Q3UP78
Domain Number - Region: 159-271
Classification Level Classification E-value
Superfamily SRCR-like 0.000106
Family Scavenger receptor cysteine-rich (SRCR) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3UP78
Sequence length 494
Comment (tr|Q3UP78|Q3UP78_MOUSE) Uncharacterized protein {ECO:0000313|EMBL:BAE25519.1} OX=10090 OS=Mus musculus (Mouse). GN=Cd5 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MDSHEVLLAATYLLGTLAAFCLGQSGRGGLDIQVMLSGSNSKCQGQVEIQMENKWKTVCS
SSWRLSQDHSKNAQQASAVCKQLRCGDPLALGPFPSLNRPQNQVFCQGSPWSISNCNNTS
SQDQCLPLSLICLEPQRTTPPPTTTPPTTVPEPTAPPRLQLVPGHEGLRCTGVVEFYNGS
WGGTILYKAKDRPLGLGNLICKSLQCGSFLTHLSGTEAAGTPAPAELRDPRPLPIRWEAP
NGSCVSLQQCFQKTTAQEGGQALTVICSDFQPKVQSRLVGGSSVCEGIAEVRQRSQWEAL
CDSSAARGRGRWEELCREQQCGDLISFHTVDADKTSPGFLCAQEKLSQCYHLQKKKHCNK
RVFVTCQDPNPAGLAPGTVASIILTLVLLVVLLAMCGPLVYKKLVKKFRQKKQRQWIGPT
GVNQNMSFHRSHTATVRSQVENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSTQPDN
SSDSDYDLQVAQRL
Download sequence
Identical sequences P13379 Q3UP78
ENSMUSP00000025571 ENSMUSP00000025571 10090.ENSMUSP00000025571 ENSMUSP00000025571 NP_031676.3.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]