SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UPR9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UPR9
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000235
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000327
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3UPR9
Sequence length 264
Comment (sp|Q3UPR9|SBSPO_MOUSE) RPE-spondin KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Sbspon; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MKTLWMVLCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRLTG
DCCFDYDRACPARPCFVGEWSPWSGCAGQCQPTTRVRRRSVRQEPLNGGAPCPPLEERAG
CLEYSSSQSQDCGHSFVPAFITSSVFNKKRIIQAVSPQWSTHTKDAGYCMEFKTESLTPH
CALVNSPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLRWQAIGNPRC
QGTWKKVRRVEQCSCPDVHRFIFI
Download sequence
Identical sequences Q3UPR9
ENSMUSP00000047730 10090.ENSMUSP00000047730 ENSMUSP00000047730 NP_001028460.1.92730 ENSMUSP00000047730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]