SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3UPW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3UPW5
Domain Number 1 Region: 24-266,306-381,497-547
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-65
Family FAD-linked reductases, N-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 361-484
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.84e-31
Family L-aminoacid/polyamine oxidase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3UPW5
Sequence length 555
Comment (tr|Q3UPW5|Q3UPW5_MOUSE) Spermine oxidase, isoform CRA_a {ECO:0000313|EMBL:EDL28321.1} OX=10090 OS=Mus musculus (Mouse). GN=mCG_15175 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLAGLAAARALLEQGFTDVTVLEASSHI
GGRVQSVRLGDTTFELGATWIHGSHGNPIYQLAEANGLLEETTDGERSVGRISLYSKNGV
ACYLTNRGCRIPKDVVEEFSDLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREKVRNRI
RDDPDDTEATKRLKLAMIQQYLKVESCESSSHSIDEVSLSAFGEWTEIPGAHHIIPSGFM
RVVELLAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEPRGEGDHNHDTGEGGQSGENP
QQGRWDEDEPWPVVVECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLPTEKVAAIHRL
GIGTTDKIFLEFEEPFWGPECNSLQFVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY
GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQFTGNPNIPKPRRILRSAWGSNPYFRG
SYSYTQVGSSGADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKYYSTTHGALLSGQREA
ARLIEMYRDLFQQGP
Download sequence
Identical sequences Q3UPW5 Q99K82
ENSMUSP00000028806 MmR15 NP_663508.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]