SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3V1H3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3V1H3
Domain Number 1 Region: 24-212
Classification Level Classification E-value
Superfamily Cupredoxins 9.13e-58
Family Multidomain cupredoxins 0.0000024
Further Details:      
 
Domain Number 2 Region: 376-571
Classification Level Classification E-value
Superfamily Cupredoxins 1.41e-53
Family Multidomain cupredoxins 0.00000406
Further Details:      
 
Domain Number 3 Region: 221-365
Classification Level Classification E-value
Superfamily Cupredoxins 4.29e-49
Family Multidomain cupredoxins 0.00000959
Further Details:      
 
Domain Number 4 Region: 729-913
Classification Level Classification E-value
Superfamily Cupredoxins 2.24e-46
Family Multidomain cupredoxins 0.00000639
Further Details:      
 
Domain Number 5 Region: 920-1066
Classification Level Classification E-value
Superfamily Cupredoxins 3.06e-45
Family Multidomain cupredoxins 0.00000486
Further Details:      
 
Domain Number 6 Region: 574-718
Classification Level Classification E-value
Superfamily Cupredoxins 4.19e-42
Family Multidomain cupredoxins 0.0000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3V1H3
Sequence length 1159
Comment (sp|Q3V1H3|HPHL1_MOUSE) Hephaestin-like protein 1 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Hephl1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MFLKQPGGCILLQFLGLLGLVGAVTRTYYIGIVEEYWNYVPQGKDVITGKSFSEDKLATL
FLERGPNRIGGIYKKAVYRHFTDGSYSTEIPKPPWLGFLGPILRAEVGDVIVIHLMNFAS
RPFSLHPHGVFYDKDSEGALYPDGTSGRNKEDDMVPPGKNYTYVWPVREEYAPAPADANC
LTWVYHSHIDAPKDICSGLIGPLLVCKEGVLNRYSGMRTDVDREFVIMFTLVDENQSWYL
DDNIKQFCTNPNSVDKSDAVFQRSNKMHALNGFLFGNMPEPEMCVGESVSWHLFGMGNEI
DIHSIYFYGNTFITRGHRADVVNLFPATFLTTEMIVENPGKWMITCQVSDHLQAGMLGQY
SVGNCRGNAPHPKVQGQQRRYFIAAEKVLWDYGPQGYDKFTGFPLNTSGSDSAVYFTQAD
NRIGGKYWKARYTEYVDATFSRRKMPSDSEAHLGILGPVIKAEVGDILLVTFANKADKVY
SILPHGVFYDKASDAAPNVDGFLKPGAHVKPGETFTYRWTVPESVSPTDEDPPCLTYLYF
SAVQPIKDTSAGLVGPLLVCKKGTLNADGTQKGIDKEFYLLFTVFDENFSSYLDENIKKF
TWHPFSVDKEDKEFVKSNRMHAVNGYMYGSQPGLSMCKKDRVSWHLIGMGTDTDMHGVYF
QGNTIHLRGTHRDSLALFPHMATTAYMQPDHSGIFKVFCSTLPHFTRGMGQIYEISSCGN
RDPSEPPYGMLRTFFIAAEEVEWDYAPNKNWEFEKQHLDAGGERHGDIFMNHTENWIGSQ
YRKVVYREYTNGEFVEIKARPPQEEHLQLLGPMIHAEVGDSILIIFKNKASRPYSIAAQG
VEDSNNGKLLNVPVTKPGEIKTYRWNVPKRSGPGPSDPNCIPWVYFSTANFVKDTYSGLM
GPLITCREGVLNEKGRRSDVDYEFALLFLVFNENESWYLDDNIKKYLNKDPRDFKHTDDF
EESNKMHAINGKIFGNLPGLIMTEDSMTNWYLLGIGSEVDIHTIHYHAESFLFKIDKSYR
EDVYDLFPGTFQTIELFADHPGTWLLHCHVSDHIHAGMETTYTVLRNIDNRIPYSTKTPS
GAGSHAVTVPSQEQPGKEELYFFGKNLRPRGAKAALVILFILGLLLLVATVVLALRLRSS
RRQMAYREVQSCALPTDAL
Download sequence
Identical sequences Q3V1H3
ENSMUSP00000124518 ENSMUSP00000124518 ENSMUSP00000124518 NP_001158269.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]