SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3YBN0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3YBN0
Domain Number 1 Region: 43-170
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.88e-20
Family Carboxylesterase 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3YBN0
Sequence length 172
Comment (tr|Q3YBN0|Q3YBN0_YEREN) Enterochelin esterase {ECO:0000313|EMBL:AAZ75695.1} OX=630 OS=Yersinia enterocolitica. GN=fes OC=Yersiniaceae; Yersinia.
Sequence
LAQNDPFNHTAPHASYRGRALSAVHLADAIPQTVWQPIDAGQQLPTDTQRLQLITWHSEL
LGNSRNVWIYHTHGTADNAERPLAILLDGQYWATRQPIFGVLDNETDAGRLPASVYVLID
IIDQPHRSVELPCNQDFWQALQTELLPQVAALQPFTDQASRTLVAGQSFGWV
Download sequence
Identical sequences Q3YBN0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]