SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3ZC52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3ZC52
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 8.54e-23
Family Dienelactone hydrolase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q3ZC52
Sequence length 224
Comment (sp|Q3ZC52|TEX30_BOVIN) Testis-expressed protein 30 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=TEX30; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MSHTEVKLKVPFGNKLLDAVCLVPNKSLTYGVILTHGASGDMNLPHLTSLASHLASHGFF
CLRFTCKGLNIVHRIKAYKSVLNYLKTSEYKLAGVFLGGRSMGSRAAASVLCHIEPDDAD
DFVRGLICISYPLHHPKQQHKLRDEDLFRIKDPVLFVSGSADEMCEKNLLEKVAQKMQAP
HKIHWIEKANHSMAVKGRSTNDVFKEINTQILFWIQEITETDKK
Download sequence
Identical sequences Q3ZC52
NP_001069763.2.59421 NP_001069763.2.76553 XP_005909986.1.15283 XP_006042299.1.26621 XP_019827247.1.53367 ENSBTAP00000035234 ENSBTAP00000035234 9913.ENSBTAP00000035234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]