SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q469L1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q469L1
Domain Number 1 Region: 450-555
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000192
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q469L1
Sequence length 566
Comment (tr|Q469L1|Q469L1_METBF) Sulfate transporter {ECO:0000313|EMBL:AAZ71431.1} KW=Complete proteome; Reference proteome OX=269797 OS=Methanosarcina barkeri (strain Fusaro / DSM 804). GN=Mbar_A2518 OC=Methanosarcinaceae; Methanosarcina.
Sequence
MKPAQNSRRSFHYSLFQGILPLKSKQIPLEIAAGITFAAFAIPEVMGYTKIAGMPVVTGI
YTILFPMLAFAIFGSSRHLVVGADSATAAIIASGLTTIAVPGSSQYVAYASAIALLVAIL
LFLGGLLQLGFLADFLSYTILIGFLTGVGIYISISQISGMLGIPSEPDGTSVQILSLVRN
LSLTNTSTLLVSLSVIGVIVLGEKLSHKFPGSLIAIIGAIAASRILDLSSYGISILGAVP
QGLPQISLPQIPLSNLPEIFNISISCFIIILAQSAATSRAYAIKFSDTFNENTDLIGLSL
ANAAAGISGTFVVNGSPTKTEMIKNAGGRTQLTQLTTVFTVILVLLFFTRPFAYLPTAVL
SSMVFLIGLHLIDIKGMTSLHRQRPVEFAVALITAITVVVIGVEQGILIAIVLSIIAHLR
HSYRPLNLLLVPKAGGAMKTFPLESGQQAVEGLLIYRFGSNLYFANEGRFAEEIIDLAIK
NGSLKWFCISATNIGDIDFTSAETLKKVYTELQKLDITLVLSEVVQPVMNELDRDGITQM
IGKDHIFESVQDVIEEYKRSTDSSLR
Download sequence
Identical sequences A0A0E3QNN9 Q469L1
gi|73669996|ref|YP_306011.1| WP_011307474.1.36239 WP_011307474.1.74748 269797.Mbar_A2518

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]