SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q46T95 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q46T95
Domain Number 1 Region: 51-323
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 4.19e-23
Family Phosphonoacetate hydrolase 0.061
Further Details:      
 
Domain Number 2 Region: 433-667
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000211
Family Clostridium neurotoxins, the second last domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q46T95
Sequence length 678
Comment (tr|Q46T95|Q46T95_CUPNJ) Uncharacterized protein {ECO:0000313|EMBL:AAZ63639.1} KW=Complete proteome; Reference proteome OX=264198 OS=(strain JMP 134)). GN=Reut_B4286 OC=Burkholderiaceae; Cupriavidus.
Sequence
MAWILARPAPGRYALSLAMAGVAAAALTACGGDDAQPTAANPSDSGNKTNLAPAASKVLL
VGVDGATYEQVQSAILRRELPNLAQLNLVPAATGGMPGTVTAQPPLDAPSWATVLTGTWS
NRHGVTDDTRSVAPQAPSLFRYFRDGAKAGTQLGSAISSAVVPPLLTAERDAGNLDTLVD
CASADSCVTQNSVKLVQAGYGLVFAQYSAPALAAEADGFGAGTYATALAGFDQALGQLLA
AVAERRKAQPNEDWLVMVTTSHGLDATGATTSVPTVENRTAFIAMNKPLNAALASTGTAA
PVTPADLSALPTEADIAPTLLTHAGIAIDATAYRFDGMPLNGASAGVRGIRMAVGRYNDS
IELTWQNASASAGETLVLRDGVQIAKLPASATQYVDNAFDMPTGLYRFNYTLVRNGVPVS
YQAQINYVKPVPLATTLRDNLATYFSLDTKPPVDAKGSATLGPWLPATDGGTLVDDNFGT
KGLRVDSNVDAYELVQNGADIAQSLQFTIGLWFRTDCTQGNGTGEPIISNKNYTSGANPG
IALGLFGSCEVRFNIGSGGGKRDDINGMKVSANQWAYLALSVDTVAKKFSAYVIDPVLGL
QKVENKAIASTDVTKLNGLATKVWGLNDDATHNYVANNAGSLKGVMAFNDLAMWTRVLTL
DELKSITASRQPLSSLNP
Download sequence
Identical sequences Q46T95
gi|73538116|ref|YP_298483.1| 264198.Reut_B4286 WP_011300405.1.84135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]