SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q475E4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q475E4
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.37e-47
Family Methylesterase CheB, C-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q475E4
Sequence length 328
Comment (tr|Q475E4|Q475E4_CUPNJ) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=264198 OS=(strain JMP 134)). GN=Reut_A0607 OC=Burkholderiaceae; Cupriavidus.
Sequence
MTRNVVTIGGSRGAFTVLRDVVAALPAALDAAVFIVLHVGKHKSELPSLLTRWGKLPASY
PQHGDVWKPGHIYVAPPDHHMLITADTIHLSHAAKENFSRPAIDPLLRSAAVALGSRVIG
VILSGDLDDGAAGLAFVRAFGGRTLIQNPRDAEATSMPKSAMEAAGADLMASPAELGHAI
VALLQASGEGEFDPKREKDMQALRSEAATADNPAGSAFEELDSIAARAAITCPECGGAMW
QLRDTHPLRFRCHTGHAFSGMTLTAAEDKATEHAMWTAVRAQKEALALARIRAAHAKSDG
NRDAYQIELSRIQQCERLLKVLQGAIAE
Download sequence
Identical sequences Q475E4
264198.Reut_A0607 WP_011296795.1.84135 gi|73540313|ref|YP_294833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]