SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q498H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q498H2
Domain Number 1 Region: 78-216
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.48e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.75e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q498H2
Sequence length 220
Comment (tr|Q498H2|Q498H2_XENLA) Uncharacterized protein {ECO:0000313|EMBL:AAI00219.1} OX=8355 OS=Xenopus laevis (African clawed frog). GN= OC=Xenopus.
Sequence
MAEKPVLHYFNGRGRMESIRWLLAAAGVEFVEKYIETREQYEQLLKDGILMFGQVPLVEM
DGMKLTQTKAILSYLAGKYNLYGNDQKERLFIDMYVDGTSDLLSLGLMYIFLDDSVKEKQ
KEKIKESATNRYFPVFEKVLKDQHFLVGNKFSWADVQLMEAILMTEEFHGDILSCFPNLQ
DYKERIKQIPTIAKFLQPGSPRKPFPDEKYLKTVKTVLKM
Download sequence
Identical sequences Q498H2
gi|71679806|gb|AAI00219|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]