SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4Q3Q3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4Q3Q3
Domain Number 1 Region: 5-103
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000000000439
Family PWWP domain 0.011
Further Details:      
 
Domain Number 2 Region: 319-381
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000471
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0048
Further Details:      
 
Domain Number 3 Region: 549-590
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000425
Family Transcriptional factor domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4Q3Q3
Sequence length 593
Comment (tr|Q4Q3Q3|Q4Q3Q3_LEIMA) Uncharacterized protein {ECO:0000313|EMBL:CAJ06792.1} KW=Complete proteome; Reference proteome OX=5664 OS=Leishmania major. GN=LMJF_33_2820 OC=Leishmaniinae; Leishmania.
Sequence
MSASTSADYPVNSWVWVRQSGYPWWPAMVLDPAQAGQDPPEGTDVVLLCGPSASATLVFA
SSADAEQLRPYHGAAEDAELIEAGRSDESCAAAIEEMLAAVASTDAAPSEEGLHTTPSAS
GAAMGHGNHAFSGEDDVDWEALAAEAEAAMAEPQSAVAQEKHKKDKKHNKRKSNGSSGGD
GHADCDGSRKTRKDKSSKGHRRHRGGDADSANEAEVSSGGDNDDSKNDEDVFQRRKGAFS
SRSAMKKVKYERQSKLEEYDLGPGTLSDYSPRNDPAYYYRKVRSARRAASSTELRTCTQE
LRGFMSRCLSGAATALDVEADILGVLRQLKNVDVTLAQLQETGVGVAIGSLLRFFTPPVV
QLAQAILNYWFHSLPQNTQQQLSAENEVDRCSIETCSDGVAGDNELGRIGVNLFSCFTNE
EINDAPASVDVMALCGSIEDALERRCDSDAQMLVLFAFGDTSDTGKALRRLLLEGKIYVE
DIINHTGNLPLLVRTRQRRPANMQFTFDSPAPQDRSDIDSPNSPYAAFSPNDDGSTGSPT
FGSPTGRTTTALYSCPHCGANDAYQSSYSVQAHDNMPDILRCKKCGQTWNVAE
Download sequence
Identical sequences Q4Q3Q3
gi|157875292|ref|XP_001686045.1| gi|68129118|emb|CAJ06792.1| XP_001686045.1.98313 psu|LmjF33.2820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]