SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4Q5I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4Q5I7
Domain Number 1 Region: 542-677
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.09e-23
Family Staphylococcal nuclease 0.0027
Further Details:      
 
Domain Number 2 Region: 361-510
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-20
Family Staphylococcal nuclease 0.013
Further Details:      
 
Domain Number 3 Region: 168-299
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 7.19e-20
Family Staphylococcal nuclease 0.0032
Further Details:      
 
Domain Number 4 Region: 4-144
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 5.49e-16
Family Staphylococcal nuclease 0.016
Further Details:      
 
Domain Number 5 Region: 779-929
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000000000288
Family Staphylococcal nuclease 0.017
Further Details:      
 
Domain Number 6 Region: 739-829
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000369
Family Tudor domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4Q5I7
Sequence length 934
Comment (tr|Q4Q5I7|Q4Q5I7_LEIMA) Uncharacterized protein {ECO:0000313|EMBL:CAJ08615.1} KW=Complete proteome; Reference proteome OX=5664 OS=Leishmania major. GN=LMJF_32_0950 OC=Leishmaniinae; Leishmania.
Sequence
MSYVVYAVENADRMILMGPTVADQPTFKAITLSYIQAPKLARRTASGDFTPEEPYAYEAA
ELIRSTFIGKQVQFVEDYYIEALQRSAGRIMGSNHQEATGMLLKEGLATLPDRLPPRIEK
ELYEIYSQMSASARAARKGLFSGDGAKHVRHMRSYAPEELAEKIEGVKGQQLLSRVEKVV
SPTLLIISVKELGDTQFAAHLTGVTAKDNGDESINAEAKFFVERLLQNRNVKVRYDGLDG
FNNVMISIMSPKGSFQEELLSKGYVKVQNMTLPLSTRIDEIISAEAAAKKKRVGCWKNYV
EPVVVAPTETAEGDNGASAPAANGEEAPVDSKAPAAPKVAGLPTTLPDGTPGPVYTGPIE
FVGTLVQVVHGDTVVVRDDASGHLFRVSLAGVRSSKNIDRDQDGNSPETRVTYRDYAWEA
KEFLRSRYIGSKVVVLVEYARVMPETKEIRPAATVEVKHTGVNIGVALLETGYATFFLGR
NDKNSKASELAAAEDGAKEEKKGIHRDTPAPPMKVVELNHLGETRSRYYLSFLQRGMQGN
RPPPLKGVVDLVLGPSSLRVYIPKENFQIPVKVAGIVTPSAAFNANEKADPFAQEAKDFV
IDLVQQRNVTIQVFTSDRAGNFISSITMEDGTNISVALVAKGFATVANADRLPFAQQLVD
AEGAAREAKKHIWSATGAIPQRAVKMEQERAASNPQALARVVDETSKFSLYMITEIADDG
LSVYLQGYDAEQDRKKGHIQDLINRTVAGDGHTPKKGESVIAQYSGDKTWCRATVLKAPR
DDKAEVKFIDFGNTETVPVKNIRAVPRGPEYALVRDTPAFAKLARLAYLKSGDANEMFAG
ATYAAVEEYSDGEVLAKAVYRDGLGNVYYTVTTNEKVPSLSEMLLQRGLALLDRRASAVD
PTDYRRHEAAQEIARKGHKNLWQYGDVDEGDVDY
Download sequence
Identical sequences Q4Q5I7
XP_001685411.1.98313 gi|157873819|ref|XP_001685411.1| gi|68128483|emb|CAJ08615.1| psu|LmjF32.0950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]