SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RAH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RAH9
Domain Number 1 Region: 3-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.81e-68
Family Ankyrin repeat 0.00000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4RAH9
Sequence length 341
Comment (tr|Q4RAH9|Q4RAH9_TETNG) Chromosome undetermined SCAF23645, whole genome shotgun sequence {ECO:0000313|EMBL:CAG14604.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00038141001 OC=Tetraodon.
Sequence
LLLQAYHGHAQALEVLLQGETDVDQRDEAGRTSLALAALRGHIECVHTLLSQGASPHTAD
SQHGRTPVHLAVMNGHTSCVRLLLDDSDGADLTDAADSQGQTPLMLAVVGGHVDAVSLLL
EREASVNVSNKHGFTALHLGECIQCLLEQEASVLLGDSQGRTAIHLAAARGHASWLSELL
NIACAEASSLPVLRDLGGYTPLHWACYYGHEGCVEVLLEQKGCRCIDGNPFTPLHCAVGN
NHEPCASLLLEAMGSDIVGCRDAKGRTPLHAAAFAGHVDCIHLLLSHDAPVDAVDQSGFT
PLMMAAEKGRDGALEVLLTSSSANLGLTDKDGNTALHLACS
Download sequence
Identical sequences Q4RAH9
99883.ENSTNIP00000022975 ENSTNIP00000022975 ENSTNIP00000022975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]