SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RDL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RDL7
Domain Number 1 Region: 19-78
Classification Level Classification E-value
Superfamily BPTI-like 5.53e-21
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 2 Region: 80-140
Classification Level Classification E-value
Superfamily BPTI-like 1.28e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 3 Region: 144-187
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000596
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4RDL7
Sequence length 190
Comment (tr|Q4RDL7|Q4RDL7_TETNG) Tissue factor pathway inhibitor 2 {ECO:0000313|Ensembl:ENSTNIP00000022974} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00038126001 OC=Tetraodon.
Sequence
MEFYALAAFALFSSFCNVLALAPKAVCLLQVNEGPCRGDIERYYYNTITQKCELFSYGGC
QGNANNFRSFQECQKTCFRIPKIPQICRFPQEVGPCRALLRKYFFNMTTMQCEPFYYGGC
LGSSNRFDDLASCKEYCSPHKSLPVLCLDPLDKGKCSASFPRYYYNKATKKCEEFIYSGC
GGNSKNFVLM
Download sequence
Identical sequences Q4RDL7
99883.ENSTNIP00000022974 ENSTNIP00000022974 ENSTNIP00000022974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]