SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RIE8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RIE8
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000112
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4RIE8
Sequence length 283
Comment (tr|Q4RIE8|Q4RIE8_TETNG) Zgc:101577 {ECO:0000313|Ensembl:ENSTNIP00000021474} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00033916001 OC=Tetraodon.
Sequence
MEGTDMDVDAELMQKFRCMGTTDKDVLISEFQKLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPIANTPSMSFVEDVTIGEGESVPPDTPFTKTWRIQNTGTDAWPPGVTLKYIGG
HQFGHVNTVMVKSLDPQEISDISVQMRSPAAPGMYQGQWRMCTATGLFYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPQRNVQEDFNPFASPQKNKCDTADSSFTEPSGAWDRTRE
PNRQDQNGLSHNAVNRASNGLQSNLSVVTYGQGIHGPYPFGQS
Download sequence
Identical sequences Q4RIE8
ENSTNIP00000021474 ENSTNIP00000021474 99883.ENSTNIP00000021474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]