SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RPT7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RPT7
Domain Number 1 Region: 75-183
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-28
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 4-73
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4RPT7
Sequence length 214
Comment (tr|Q4RPT7|Q4RPT7_TETNG) Osteoclast stimulating factor 1 {ECO:0000313|Ensembl:ENSTNIP00000019800} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00030939001 OC=Tetraodon.
Sequence
MSKPPPKPAKPGQVKVFRAMYTFDPLTPDELYFEEGDILYISDMSDTNWWKGTCRGRTGL
IPSNYVAEQAESIDNPLHEAAKRGNLSWLRECIENKVGINGLDKAGNTALYWACHGGHKD
VVELLLSQPNVELNQQNKLGDTALHAAAWKGYSDIVELLLQKNPRTDIRNNEKKLAEDMA
TNAQSASLLRRKHQCNVTRTHSNAEEYLDDDDSD
Download sequence
Identical sequences Q4RPT7
ENSTNIP00000019800 ENSTNIP00000019800 99883.ENSTNIP00000019800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]