SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4RZP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4RZP8
Domain Number 1 Region: 10-202
Classification Level Classification E-value
Superfamily E set domains 1.93e-72
Family RhoGDI-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4RZP8
Sequence length 203
Comment (tr|Q4RZP8|Q4RZP8_TETNG) Chromosome 18 SCAF14786, whole genome shotgun sequence {ECO:0000313|EMBL:CAG06134.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00026383001 OC=Tetraodon.
Sequence
MAEDEVTPEQLAAIAAENEEPEPVNYKPPAQKSVKEIQDLDKDDESLCKYKETLLGPGVT
SVDPAAPNVQVTRMALLCESSPRPLILDLQGDLEALKKQAFVLKEGVEYKIKISFRVNRE
IVSGLKYVQQTYRKGLRIDKSDYMVGSYGPRDCEYDFVTSMEEAPTGLMARGQYAIKSKF
TDDDKHDHLSWEWNLNIKKDWTD
Download sequence
Identical sequences Q4RZP8
ENSTNIP00000017145 99883.ENSTNIP00000017145 ENSTNIP00000017145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]