SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4S7P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4S7P4
Domain Number 1 Region: 450-581
Classification Level Classification E-value
Superfamily TIMP-like 4.39e-26
Family Netrin-like domain (NTR/C345C module) 0.02
Further Details:      
 
Domain Number 2 Region: 226-321
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 403-457
Classification Level Classification E-value
Superfamily BPTI-like 2.55e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0035
Further Details:      
 
Domain Number 4 Region: 340-398
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000213
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.02
Further Details:      
 
Domain Number 5 Region: 141-193
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000457
Family Ovomucoid domain III-like 0.029
Further Details:      
 
Domain Number 6 Region: 52-98
Classification Level Classification E-value
Superfamily Elafin-like 0.000000209
Family Elafin-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4S7P4
Sequence length 581
Comment (tr|Q4S7P4|Q4S7P4_TETNG) Chromosome 18 SCAF14712, whole genome shotgun sequence {ECO:0000313|EMBL:CAG03338.1} OX=99883 OS=nigroviridis). GN=GSTENG00022690001 OC=Tetraodon.
Sequence
MCKINRFPSADAERMKVGTMHPAQWIPARLLMLFICVLPELSVRASAAASDVEHEGFCPN
KLNSNLWVDAQSTCERECNADEDCADFEKCCTNVCGLSSCVAARFPDGAGALLEGQGGIN
GSDAHASVATCEGFICSQQGAVCDIWDGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMD
AEACVRGVTLTVITCRFYLAGPPTSALPQETTANPTPTTSLEDPLPPTLYSNPHHQSIYV
GGTVSFHCDVIGVPRPDVTWEKQSERQERLVMRPDQMYGNVVITNIGQLVVYNAQVWDTG
IYTCIARNSVGVLQADYPLSVIRRDEDDFSEDPELPMGRPFSPADCLAEVDQRACSGERH
VDWYYDSSAGSCTAFSNGGCEDSRNRFATYEECKASCQREGMGVCSLPAVQGPCKAWEAR
WAWNSVMKECQAFVYGGCHGNANSFHTKKECEANCPQPKRKPCKACRVKGKMIPSLCRSD
FAIVGWLTELVEDLDSGLARFSLDEVLKDEKMGLTFFNTKHLEVTIAKIDWSCPCPNITM
GENPLLVMGVVQDGMAIIQSDSYVRATTERRIKRLREVVSK
Download sequence
Identical sequences Q4S7P4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]