SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4SDY0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4SDY0
Domain Number 1 Region: 33-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.6e-47
Family Extended AAA-ATPase domain 0.000000656
Further Details:      
 
Domain Number 2 Region: 264-352
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.53e-24
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4SDY0
Sequence length 357
Comment (tr|Q4SDY0|Q4SDY0_TETNG) Replication factor C (activator 1) 4 {ECO:0000313|Ensembl:ENSTNIP00000013379} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00019812001 OC=Tetraodon.
Sequence
MQAFLKGATVQTTKLQKEKAGAGSSSEKKAKAVPWVEKYRPKCVDEVAFQEEVVAVLKKS
LEGADLPNLLFYGPPGTGKTSTILAAARELYGPVLYRQRVLELNASDERGIQVIREKVKT
FAQLTVAGTRPDGKPCPPFKIIILDEADSMTPPAQAALRRTMEKESRTTRFCLICNYISR
IIEPLTSRCSKFRFKPLDNQVQEERLLAICEKENLKYSGESVSALVRVSEGDLRKAITFL
QSAARLSVDKEISERTITEIAGVVPHKMIDSLLHICFRGTFEKLEVEVRNLVDEGYAATQ
ILSQLHESIIEKDLGDKQKSAITEKMAVVSKCLSDGADEYLQMLSLCSVIMQQSSQH
Download sequence
Identical sequences Q4SDY0
ENSTNIP00000013379 ENSTNIP00000013379 99883.ENSTNIP00000013379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]