SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4SP15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4SP15
Domain Number 1 Region: 543-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000589
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 2 Region: 122-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000419
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 3 Region: 59-107
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000484
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 4 Region: 499-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000936
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4SP15
Sequence length 590
Comment (tr|Q4SP15|Q4SP15_TETNG) Chromosome 15 SCAF14542, whole genome shotgun sequence {ECO:0000313|EMBL:CAF97617.1} OX=99883 OS=nigroviridis). GN=GSTENG00015039001 OC=Tetraodon.
Sequence
MAAPALTQPRAHGMQTSLLHGFFCLLLLSGVVVATAGDEDLASVRQARSAGGQVTAQPVD
CVLSEWSAWSRCDTCQKKRYRYAKLEQPSQFGGQPCNFHGREEEACTVSSRYTCDNIPVC
EGFLCATTGRCIPRTLQCSGEDDCGDMSDEVGCRKVSKPCRSEAEEYWGIENLAKGINVL
DSNLAGVVLDNRYYAGSCLPHYIQDVRFRKPYNLEQYTLQTKGSYDFILHSYDSYSSYMD
FTLKERMTQTVVSFGFAIPGVFEFGFNYNSAKYSKSVKKLRRVSGKSYSFVRAKAQLELA
QYMLKSNDLMLHPEFLHRLRALPLSYVYGEYRQIFQDYGTHYITEAALGGEFEYTIILNK
ERLEQSDYTLEDYKKCAQAGLKVGANIYGVYVSAGVHGGSCNGLLNEMGENTARGSMVED
FVSVVRGGTSESITALLSKKLPTPELMRLWGEGVQFNPDFIRRTTQPLYELVTSRDFSQA
STLKRNLKRALSEYLAEASACRCAPCLNNGVAVLRGTRCDCICPVGYTGDGCEITTRRGD
VAIDGSWSCWGPWSSCSGGTVTRSRQCNNPAPSFGGMACRGLQQESTSCS
Download sequence
Identical sequences Q4SP15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]