SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4T526 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4T526
Domain Number 1 Region: 18-234
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.07e-84
Family Fibrinogen C-terminal domain-like 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q4T526
Sequence length 235
Comment (tr|Q4T526|Q4T526_TETNG) Chromosome undetermined SCAF9454, whole genome shotgun sequence {ECO:0000313|EMBL:CAF92006.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00007031001 OC=Tetraodon.
Sequence
MKESLVLLLLAVPILDSGHVVSMPADCSEIHNSPSGEYTICPAGDRSAVMVKCDMDTDQG
GWTVIGARTDGTVNFYRPWNQYKLGFGSPLSEHWIGLDNLHYMTSNKKYKLRVVLEDFDG
NTVFANYGSFSVGDECSGFQLTVGGFTDGGAGDALSHHNQMKFTTLDRDNDLYEKNCAKE
FLGAFWYHKCHHANPNGVYRWGLDGTLFAVGVSWYPWKGHEYSLKKYIMMIRPVQ
Download sequence
Identical sequences Q4T526
ENSTNIP00000006829 99883.ENSTNIP00000006829 ENSTNIP00000006829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]