SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4TBH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TBH2
Domain Number 1 Region: 161-356
Classification Level Classification E-value
Superfamily E set domains 1.21e-70
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000412
Further Details:      
 
Domain Number 2 Region: 49-176
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.01e-22
Family Voltage-gated potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4TBH2
Sequence length 432
Comment (tr|Q4TBH2|Q4TBH2_TETNG) Chromosome 13 SCAF7124, whole genome shotgun sequence {ECO:0000313|EMBL:CAF89760.1} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00003759001 OC=Tetraodon.
Sequence
MLARKGLLPDGFLLTRLAEDRNQPNRGRSRSQRARFITKTGSCNVAHKNIREQGRFLQDV
FTTMVDLKWQHSFLIFTSAFLCSWMLFAMIWWLLAFAHGDLEPRDPGGDPGPVPCVTAIH
SFTSAFLFSIEVQVTIGFGGRMVTEECPLAITVLIIQNIVGLIINAVMLGCVFMKTAQAN
RRAETLIFSRNAVIAPRNGRPTFMFRVGDLRKSMIISATIQLQVIRRTVTAEGEVIPVAQ
LDIQVENPLRSNGIFLVSPLVISHTIERGSPLYELSAQALSAEDLEIIVILEGVVETTGI
TMQARTSYTPEEILWGRRFVSIISEEDGRYCVDYSKFGNTVPVRMPLLSAKELDQSRGVE
EASPHSPLQGWGLVRAGRGGFRRGGRTCHGAAAPPWYAQTDGEVEGKGQKKKVQLEVIGQ
QNDEDGLGEMSE
Download sequence
Identical sequences Q4TBH2
ENSTNIP00000005244 ENSTNIP00000005246 ENSTNIP00000005244 ENSTNIP00000005246 99883.ENSTNIP00000005244 99883.ENSTNIP00000005246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]