SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4TBU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4TBU5
Domain Number 1 Region: 133-225
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 4.71e-33
Family TATA-box binding protein (TBP), C-terminal domain 0.00000394
Further Details:      
 
Domain Number 2 Region: 218-307
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 2.83e-31
Family TATA-box binding protein (TBP), C-terminal domain 0.00000924
Further Details:      
 
Weak hits

Sequence:  Q4TBU5
Domain Number - Region: 96-134
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0392
Family NAD kinase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q4TBU5
Sequence length 309
Comment (tr|Q4TBU5|Q4TBU5_TETNG) TATA box binding protein like 2 {ECO:0000313|Ensembl:ENSTNIP00000005149} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=GSTENG00003607001 OC=Tetraodon.
Sequence
MDESALERYFEDSIANDSGFLLEEELSIGSPTLSSTYLPGKAGLSRGSGEELDLSFLPDE
LGTQEEPSRHNDTAQTEAQAASQDSAVCLDYNSQDSTGASLSGGGALNSPFCPMTPMTPM
TPMTPVTERSGIIPQLQNIVSTVNLGCPLDLKFIALQARNAEYNPKRFAAVIMRIREPRT
TALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVASCDVCFPIR
LEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERAEIYEAFENIY
PILRGFRKQ
Download sequence
Identical sequences Q4TBU5
ENSTNIP00000005149 ENSTNIP00000005149 99883.ENSTNIP00000005149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]